PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.284730.1
Common NameCsa_5G606470, LOC101214453
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 493aa    MW: 54095 Da    PI: 8.5279
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.284730.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.91e-33199255259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  +++v+ei+Y+geHnh+
  Cucsa.284730.1 199 DDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCPVKKKVERSL-EGQVTEIIYKGEHNHK 255
                     8****************************************.***************7 PP

2WRKY106.81.1e-33378436159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vkg+++prsYY+Ct++gC+v+k+ver+++dpk+v++tYeg+Hnh+
  Cucsa.284730.1 378 LDDGYRWRKYGQKIVKGNPYPRSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHD 436
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.6E-30184257IPR003657WRKY domain
SuperFamilySSF1182904.71E-26197257IPR003657WRKY domain
SMARTSM007749.1E-38198256IPR003657WRKY domain
PROSITE profilePS5081123.284199257IPR003657WRKY domain
PfamPF031062.9E-26199255IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.0E-37364438IPR003657WRKY domain
SuperFamilySSF1182901.16E-29370438IPR003657WRKY domain
PROSITE profilePS5081138.744373438IPR003657WRKY domain
SMARTSM007744.0E-39378437IPR003657WRKY domain
PfamPF031062.6E-26379436IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MGEDDEQPPP PPLPSKSKSF PLRPTINLPP RTSMESLFSS GPGLGFGFSP GPMTLVSSFF  60
SDSDDCKSFS QLLAGAMASP VTAVPSSSSE FKASPGLLDS PGLQGPFGMT HQQALAQVTM  120
HAVEAYSLNQ MQASSFSSSV APSASSLQLL TSLPGEKTND QLMQLPFQNS TVASKEISEN  180
SQSEQRLQLS SCNVDRPADD GYNWRKYGQK QVKGSEFPRS YYKCTHPNCP VKKKVERSLE  240
GQVTEIIYKG EHNHKRPQPN KRAKDVGNSN GYSIIHGNLE LSSQVQSGYL NKLDEETSIS  300
SIRKKDQELS RVTNDQFLGN SDGEGGSETE TGVNRKDEDE PAAKRRNIEV RNSEPASSHR  360
TLTESRIIVQ TTSEVDLLDD GYRWRKYGQK IVKGNPYPRS YYKCTTPGCN VRKHVERAST  420
DPKAVITTYE GKHNHDVPLG KTSSHSSVSS NISQLKSQNI VTEKKNSSNN TDRGNSRQQP  480
TGLLRLKEEQ IT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-43199438877Probable WRKY transcription factor 4
2lex_A1e-43199438877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004135156.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9ZQ701e-148WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A0A0KW350.0A0A0A0KW35_CUCSA; Uncharacterized protein
STRINGGLYMA02G12490.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-125WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]